SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005811762.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005811762.1.87360
Domain Number 1 Region: 98-267
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.89e-50
Family CRAL/TRIO domain 0.0000332
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.96e-17
Family CRAL/TRIO N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005811762.1.87360
Sequence length 328
Comment PREDICTED: clavesin-1-like [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MINHVPPGLSSDTTEKARMELNENPDTLHQDIKQVRDMIVTRPDIGFLRTDDEFILRFLR
ARKFDHVETFRLLAQYFQFRQQNLDMFQSFKVDDPSIKRALMDGFPGVLEAPDQHGRKIL
ILFASNWDQSRNSFIDILRAILLSLEVLIENPELQINGFTLIIDWSNFSFKQASKLTPNI
LKLAIEGLQDSFPARFGGIHFVNQPWYIHAMYTIIKPFLKDKTRKRIFLHGNNLNSLHQL
IQPECLPSEFGGTLPPYDMGMWARTLLGPDYNDETEYTLTYDALHVRESCGGGGGGEKDM
MKRSQSTVEAAALRQMDRETSTPLLALD
Download sequence
Identical sequences M4AEQ6
ENSXMAP00000012950 ENSXMAP00000012950 XP_005811762.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]