SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005813298.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005813298.1.87360
Domain Number 1 Region: 75-273
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.83e-55
Family CRAL/TRIO domain 0.0000000698
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 7.59e-36
Family Supernatant protein factor (SPF), C-terminal domain 0.00000377
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.62e-21
Family CRAL/TRIO N-terminal domain 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005813298.1.87360
Sequence length 428
Comment PREDICTED: SEC14-like protein 2 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MSGRVGDLSPKQAEALEQFRSKVQDILPQLPAQHDHFLLRWLRARNFNVQKSEAMLRKHL
EFRKHMKVDAIITDWQPPEVIEKYLSGGMCGYDREGSPIWYDVIGPVDPKGLFLSASKQD
FIKSKIRDCEMLQKECNLQSERLGRNIESITMIYDVEGLGLKHLWKPAIETYGEILQMFE
DNYPEGLKRLFVIKAPKLFPVAYNLVKHFLSEITRQKINILGGNWQEVLLKYIDAEELPA
IYGGKATDPDGDPRCRTRINHVGPVPPSYYVRDHVNVDYEHCLTVNRGSSQQMDFEILFP
GCVLRWQFACEGADIGFGVFLKTRKGEWKKASEMQEVIPSQRYNAHLVPEDGSLTCELPG
VYVLRFDNTYSIFQAKRVSYTVEVLLPDRLQSQREAQTNGTSEGTGEKSSEGTSEKSSDQ
LQDAQTRL
Download sequence
Identical sequences M4AUK9
ENSXMAP00000018154 XP_005813298.1.87360 ENSXMAP00000018154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]