SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005815470.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005815470.1.87360
Domain Number 1 Region: 180-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.71e-57
Family Voltage-gated potassium channels 0.00082
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily POZ domain 9.22e-33
Family Tetramerization domain of potassium channels 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005815470.1.87360
Sequence length 638
Comment PREDICTED: potassium voltage-gated channel subfamily D member 1 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MAAGVATWLPFARAAAVGWLPLAKKTMPKPPVDNSSRSDEILYVNVSGVRFQTWKNTLDR
YPDTLLGSSEKEFFYNEDTQEYFFDRDPEMFRHILNFYRTGKLHYPRHECVQAFDEELAF
YGIVPEIIGDCCMEEYRDRKKENQERLAEDTEANEATDAPLPPHSTSRERLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCRPPKGSVKDLPCGEKYQLAFFCMDTACVLIF
TFEYLMRLFAAPSRCKFMRSVMSVIDVVAIMPYYIGLVMPENEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTKGSTFTSIPAS
FWYTIVTMTTLGYGDMVPNTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KMRAQQKVRLARIRMAKKGTSNAFLQYKEDHTLGDRNSDSTALCVKNRSAFEHQHNHLLH
CLEKTTNHEFTDEMTYSELCMTESVGFRTSRSTSLSSQQGAQNNSTGCCPRRARRRAAMR
LANSTVSVSRGSVQELDTLQFKTTSIPPQTRSSLNAQPDNLKLNCGDQDFTAAIISIPTP
PANTPDESLPPTPTPVPGILRNTRATAYTHETVKISSL
Download sequence
Identical sequences M4AL93
ENSXMAP00000015237 ENSXMAP00000015237 XP_005815470.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]