SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005822108.1.50599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005822108.1.50599
Domain Number - Region: 556-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0343
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005822108.1.50599
Sequence length 1844
Comment hypothetical protein GUITHDRAFT_80080, partial [Guillardia theta CCMP2712]; AA=GCF_000315625.1; RF=representative genome; TAX=905079; STAX=55529; NAME=Guillardia theta CCMP2712; strain=CCMP2712; AL=Scaffold; RT=Major
Sequence
MITYRFNTPSTPPYTTACGEGGIDGGATCPTYPSKLYYKNAGEFDQAVAFIGRYGNHTPA
GNYVVLYDGEGEIQFGGDASVIPRVPNDKYSDARDIYISVSPAIGVEVRIVRTNETNPVR
NIRILPLDGPDFLSTSTFTSVFLEALRGLQVIRFGFWQETVRPGDDGPANNAPRLWKHRA
LPEGPQGHQQWRKALVDPGVAIELMVELANTLHASPWFCMPPPSPESVSSTDVFDDYNSK
FATLVGTTLDPSLQVYVEWSSGTGYANWDKTKSLAVFRAWTKTFNDLRASNMSVPRLVRV
VSTTKFVSEITDHFGSDLQFVDAFGVSAKFGMETTDVVNDPTGEWFQDFDFPLKHPNITV
NEILDLMRENSMHSEQKLNTLIQRFRAIYLIKTGRPDVPVLAYRGGSWVNARSFGHRAAV
YNIQMCISRDVFPCETTYGYGVLDGPLTASTTLVTATANAALELQLEQKLINASRHPRMT
GIYMDFIERWRRIGGGVFVTSELYKPAGICPTGGKDCANNGLMESLSDSPKLRAVKNYIN
GVPLIEPFTSADLHQEAEVPCSPACVHGTCWQGACECWRGFAGASCTEVVPRPNQCEHDI
GMNVGGISDWSTEWTFVDVFKASRDWIPQDFTSFTWATGIPIEVSDLGDNDYPTRLKPNQ
RVGTMMIRDLYGHAPAGVYVVTYDGDGILSPIMSDIKSVRRGVGRMEVEVQPSTVFNNGF
FLVIERTNPADPIRNIRVIMPGFEHRAKSFPFHPWYLQSIEHYRALRFMDWDGVPIELMV
RLANEIGADPWFTVPYNADDEFVREMAGLVLSTLRKDVKVYLEWTNEAWHTGFEGGKYAQ
LMGLQLGLQQGGWYGGDANEARFCYIGYRTAQIARIWKQVFGAEADRVIVVASTQAVWTI
VTDKLLSCQDAYKDIDVVGIAPYFGGYDPKNASLTLDILFRETIPKSIAEGRALLVEHGR
IASRYNKTLVLYESGQSLVGDGSAKDLGILANRDERMGLMYQMYYKDMLNIGMRGIKMHF
SSAGRPSKYGSWGLLEATDQNRAFAYKYQALLQHMEDEFNCIIRPYGGCPNNCSSHGECL
SSGACACYYGYEGSDCSVIRYMDVVDCGYKCTFDQGSCDLLRTEDEITRYFGCHCEDGFF
GVTCSLFNDTCNGNGEAIDLDVCSCYPGYAGDHCEFDCSCNGHGRCSADQSSCICDKGWR
AGAGGCEWDCDCPDGVECIGPGECGCLPACQHGTCHHGSCLCWVGAEGRACEVLKNESDG
RTGVGLNLGGAAYWSTQWIFTDAMKQSSEWFAHRADDMGPGAWDTGEPIYVDGKGWPVRL
GPRQALGKLLMRNVLQHAPTGTFTVEYEGKGSMTFGFDSKVVTRSKNRMEVVFRPSVDWT
CAESFQAYCGDNGMYLKIEESDPRDPIRNIRILAPGLASLGSHSEFHPWFLRDIAPFGIL
RFMDWQGTNDATVQEWKDRTRTDFASQANVNKLKDAGMALEHMISVSNILRSSPWFCIPH
TASDDYVRQMARLVRETLRKDVKVYVEHSNEVWTSGHKSGAYCEQRGLELGLSSDKNEAR
WRYNALRSRQIWDMWREEFKEEPSRVVRVLSTWAISPRTTTTMLQFNETWRATDLLATTG
YLDCRGLGSDRKTQALTMTVAAILDECEKSVDDVIASYQEHKNIADQYNIPVGFYEAGPG
LVEASAISSGSFTASLTRKFIEAHRSPRMGDIYRSLLSRLNASGLLSPRSPWMHFSSVGN
PTQYGSWGALEYTGQPREEAHKYRALLPFLSERTRMQQTCVNLSLPSRPSVLLLQQGFYG
PPAVTSPRAGDVWGEGERRMVRWDAAGAGARQFVQVSLWHLTDC
Download sequence
Identical sequences L1IFV5
XP_005822108.1.50599 jgi|Guith1|80080|e_gw1.132.34.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]