SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005828404.1.50599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005828404.1.50599
Domain Number - Region: 235-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000278
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 27-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00136
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00686
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 76-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00686
Family Integrin beta EGF-like domains 0.047
Further Details:      
 
Domain Number - Region: 163-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005828404.1.50599
Sequence length 260
Comment hypothetical protein GUITHDRAFT_46664, partial [Guillardia theta CCMP2712]; AA=GCF_000315625.1; RF=representative genome; TAX=905079; STAX=55529; NAME=Guillardia theta CCMP2712; strain=CCMP2712; AL=Scaffold; RT=Major
Sequence
CSRKGLCLPDATCSCNVGFTGPDCSIKCKGEVGKPCSFNGVCLSDGSCACYYGYRGDDCR
FLCPGQDSMVFTGASGWECSGRGTCDSFPLPLGACVCNSGFRGVGCELECPSNVHPANTS
SCSGHGYCRADATCDCQYGMPANVDSGWRGGGCQVECLGGATNVCSGHGRCLQDGNCTCD
SGYRLSACQRECDGGAADPCNGNGNCLEDGTCLCEVAYRNYSCSILCPGGPLPPKICSGH
GVCDVEGVCICKSGWIGRAC
Download sequence
Identical sequences L1IZT6
jgi|Guith1|46664|gw1.60.39.1 XP_005828404.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]