SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005836011.1.50599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005836011.1.50599
Domain Number 1 Region: 341-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000599
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005836011.1.50599
Sequence length 559
Comment hypothetical protein GUITHDRAFT_136216 [Guillardia theta CCMP2712]; AA=GCF_000315625.1; RF=representative genome; TAX=905079; STAX=55529; NAME=Guillardia theta CCMP2712; strain=CCMP2712; AL=Scaffold; RT=Major
Sequence
MSVSQTAPVRQGRLLQRATWLLVLVLHALSFAFCHGCSVLISAEPHHDCQERTWVLEGGV
KGHWSQGIDILVFECEMVNLVLMASGCEAAEQQPVKVRIDTGEHFIHRGSYTSSEQPSFR
LEIPGVSESGIDVPLLHLADGMYNLTAHFGHPLHLAASTMFAKLSPHVNPALEVMFPPQR
YTFGNDMEPFLQVYVQDRDASIAASGTTAGASKQLAFYLNITIRRLEGEEVVEEKTVMEW
SPNSRKIFLGRHMEASGTYKIEMVIYDAVLRPTDAREEVLVMISHSSRSPLACIAGEPEC
TPQATDRTGEEWFQGGNHSTFLDRLVDAVQSHCPQISPQDRHCRDKEQDACSGHGWCLDS
FCYCYQDYAGPKCDTHLLSALQYLPSSYPTQDVSHCHQSIALSRGMEGLSRTYNALQNPA
VCDDSKSIQRRFNKTQGLGVTFRWLSLSLLLSLAEQKTLLIGGKWRAFNFEGCSDRGLWC
YLLPSSNCSVSSWRWEEISEKDFYMPQVLVVPSEGIDQGQLWWSSQMTHLIMRPSVDLKE
KVRRIKVKEEEEEEEEEED
Download sequence
Identical sequences L1JKK2
XP_005836011.1.50599 jgi|Guith1|136216|fgenesh2_pg.19_#_60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]