SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005856499.1.60319 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005856499.1.60319
Domain Number 1 Region: 140-298
Classification Level Classification E-value
Superfamily PH domain-like 3.95e-33
Family Pleckstrin-homology domain (PH domain) 0.0000549
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 4.44e-22
Family Pleckstrin-homology domain (PH domain) 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005856499.1.60319
Sequence length 425
Comment PREDICTED: pleckstrin homology domain-containing family A member 2 isoform X1 [Myotis brandtii]; AA=GCF_000412655.1; RF=representative genome; TAX=109478; STAX=109478; NAME=Myotis brandtii; AL=Scaffold; RT=Major
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTQANYLLWYMDNPQNLAIGAGAVGSLQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKITVPKVG
NLPLTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPINQNGGDGQEGGEPGSHAILR
RSQSYIPTTGCRVPTGHPFIKSGYCVKQGNVRKSWKRRFFALDDFSICYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQADSPEDMHSWIKEIRAAVQAL
KCHPREMSFSRSISLTRSGSSSLSGGPNSVFCRGRPPVEEKKALCKAPSVASSWQPWTPV
PQAGEKLHPPEETLEDSLFTSRLGESNTSGALPSSRIRHRSEPQHPKEKPFMFNLDDENI
RTSDV
Download sequence
Identical sequences G1PHP4
ENSMLUP00000010202 ENSMLUP00000010202 XP_005856499.1.60319 XP_005856501.1.60319 XP_005856502.1.60319 XP_006086310.1.53796 XP_006086311.1.53796 XP_006086312.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]