SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005866874.1.60319 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005866874.1.60319
Domain Number - Region: 111-153
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0141
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005866874.1.60319
Sequence length 196
Comment PREDICTED: loss of heterozygosity 12 chromosomal region 1 protein [Myotis brandtii]; AA=GCF_000412655.1; RF=representative genome; TAX=109478; STAX=109478; NAME=Myotis brandtii; AL=Scaffold; RT=Major
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNTKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSMLPEG
ERLEPFSMKPDRELKL
Download sequence
Identical sequences G1PU12
ENSMLUP00000014754 XP_005866874.1.60319 XP_006084311.1.53796 XP_006760283.1.95426 ENSMLUP00000014754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]