SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005867796.1.60319 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005867796.1.60319
Domain Number 1 Region: 1066-1284
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.03e-81
Family Fibrinogen C-terminal domain-like 0.0000017
Further Details:      
 
Domain Number 2 Region: 717-876
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-21
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 3 Region: 541-701
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-21
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 4 Region: 891-978
Classification Level Classification E-value
Superfamily Fibronectin type III 7.85e-18
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 5 Region: 454-545
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 273-433
Classification Level Classification E-value
Superfamily Fibronectin type III 3.58e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 978-1066
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000157
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 8 Region: 220-272
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000476
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005867796.1.60319
Sequence length 1306
Comment PREDICTED: tenascin-N [Myotis brandtii]; AA=GCF_000412655.1; RF=representative genome; TAX=109478; STAX=109478; NAME=Myotis brandtii; AL=Scaffold; RT=Major
Sequence
MVPRTVCSIPPAYASSSAQDRALTSMDSSQTAWLHTLPLGCVPVGKSCLLEGLRLISPRM
GTFCFPLGLLFGSVLLVASAPAPLEPHSCSDKEQQLTVSHTYKIDVPKSALVQVEADPQP
LSDEGASLLALGEAEEQNIIFRHNIRLQTPQKDCELAGLVQDLLVRVQKLEGEMAEVKER
CDVQRCCQGAAGQGRQCSGHGTFSQETCGCRCEQGWEVVAPQGLQLLKSTEESLLVSWEP
SSEVDHYLLSYHPLGREPSRKQIQVPKEQNMVAPQGLQLLKSTEESLLVSWEPSSEVDHY
LLSYHPLGREPSRKQIQVPKEQNSYDILGLLPGTKYIVTLHNVKKGVPSSPQHLLATTDL
AVLGTAWVTDETENSLDVEWENPPTEVDYYKLLYSPLTGQEVAEVTVPKSNHPKSRYDIT
GLQPGMDYKITIVPMRGDLEGRPIFLNGRTEIDGPTNVVTDRVTEDMAVVSWDPVQAVID
KYMVRYTSADGQSWDTAVPREQSNTVLTGLTPGEAYRVHVWAEWGGQESKKANTTALTEI
DSPQNLVTDRVTETTATISWEPVQAVIDRYMVRYPSADGDTREVPVGKEQSSTVLTGLKP
GMEYTVHVWAQKGDRESQKVDTKAPTEIDSPQNLVTDRVTETTATISWEPVQAIIDRYMV
RYTSADGDTREVPVGKEQSSTVLTGLRPGVEYTVHVWAQKGDRESRKADTKAPTDIDSPQ
NLVTDRVTETTATISWEPVQAIIDRYMVRYPSADGDTREVPVAKEQSSTVLTGLRPGVEY
TVHVWAQKGNRESQKADTRAPTDIDSPQNLVTIRVTETTATISWEPVQAVIDRYMVRYTS
ADGDTREVPVGKEQSSTVLTGLRPGMEYTVHVWAQKGDRESKKADTKASTEIDSPQNLVT
DRVMETTATISWEPVQAVIDRYTVRYTSADGDTREVPVGKEQSSTVLAGLRPGVEYTVHV
WAQKGDRESQKADTKALTDIDPPRNFRPSAVTQSGGVLTWTRPSAQINGYILTYQFPDGT
TKEVQLGRGDQRFELQGLEQGVTYPVSLVAFKGDRRSRSVSIALSTVGARFPHPSDCSQV
QQNSNVASGLYTIYLHGDASQPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRTYVEGF
GDPTKEFWFGLDKLHNLTTGTPTRYEVRVDLQTANESAYAVYDFFQVASSKERYRLTVGK
YRGTAGDALSYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSE
GVNWEPWKGHEFSIPYVELKIRPQGYSGELVLGRKKRTLGENSRTF
Download sequence
Identical sequences XP_005867796.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]