SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005887521.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005887521.1.15283
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily EF-hand 1.1e-22
Family Parvalbumin 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005887521.1.15283
Sequence length 110
Comment PREDICTED: parvalbumin alpha [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MSMTDLLHAEDIKKAVGAFTAVDSFDHKKFFQMVGLKKKSPEDVKKVFHILDKDKSGFIE
EEELGFILKGFSPDARDLSVKETKTLLAAGDKDGDGKIGADEFSTLVAES
Download sequence
Identical sequences L8J4R7 Q0VCG3
ENSBTAP00000025499 9913.ENSBTAP00000025499 NP_001069582.1.59421 NP_001069582.1.76553 XP_005887521.1.15283 XP_010803641.1.76553 XP_019815673.1.53367 ENSBTAP00000025499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]