SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005888771.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005888771.1.15283
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 1.9e-19
Family Calbindin D9K 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005888771.1.15283
Sequence length 79
Comment PREDICTED: protein S100-G [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MSAKKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKN
GDGEVSFEEFQVLVKKISQ
Download sequence
Identical sequences P02633 W5PU09
ENSBTAP00000022630 ENSOARP00000013940 9913.ENSBTAP00000022630 NP_776682.1.59421 NP_776682.1.76553 XP_004021986.1.66739 XP_005701114.1.57651 XP_005888771.1.15283 XP_005982038.1.78601 XP_006040081.1.26621 XP_006078337.1.26621 XP_010828931.1.44457 XP_012026342.1.54773 ENSBTAP00000022630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]