SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005893878.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005893878.1.15283
Domain Number 1 Region: 36-184
Classification Level Classification E-value
Superfamily L domain-like 1.63e-34
Family Internalin LRR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005893878.1.15283
Sequence length 190
Comment PREDICTED: dynein light chain 1, axonemal [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MAKATTIKEALARWEEKTSQKPSEAREIKLYAQIPPIEKMDASLSTLSNCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKIL
YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAEGNWVEEATKRVPKLKKLDGTP
VIKEDEEEDN
Download sequence
Identical sequences Q2KID4 W5NR55
ENSOARP00000000645 NP_001039892.1.59421 NP_001039892.1.76553 XP_004010826.1.66739 XP_005686112.1.57651 XP_005893878.1.15283 XP_006046633.1.26621 XP_010854082.1.44457 XP_011966954.1.54773 XP_015328729.1.76553 XP_019824758.1.53367 XP_019824759.1.53367 ENSBTAP00000021183 9913.ENSBTAP00000021183 ENSBTAP00000021183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]