SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005894360.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005894360.1.15283
Domain Number 1 Region: 248-600
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.13e-116
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000196
Further Details:      
 
Domain Number 2 Region: 97-240
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.65e-37
Family Anticodon-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005894360.1.15283
Sequence length 623
Comment PREDICTED: lysine--tRNA ligase isoform X1 [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MLVQAAARLVRGSLRQTSWAQWGQRELRLCQLAPFTTIHKDKALSDKRSELKRRLKAEKK
IAEKEAKQKELSEKQLSQAAASNHSAEDGVAAEEESLDPNQYFKIRSQAIHQLKVNGEDP
YPHKFHVDISLTHFIQEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKL
QVMANSRNYKSEEEFIRINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLP
HLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII
PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPE
FTTCEFYMAYADYHDLMEITEKMISGMVKHITGSYKVTYHPDGPEGQAYEIDFTPPFRKI
SMVEELEKALGMKLPETNLFETEETRRILDDICVAKDVECPPPRTTARLLDKLVGEFLEV
TCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPVRQRQLFEE
QAKAKAAGDDEAMFIDETFCTALEYGLPPTGGWGMGIDRVTMFLTDSNNIKEVLLFPAMK
PEDKKENVATKDIPESTAPGTSV
Download sequence
Identical sequences F1MMK8
ENSBTAP00000020818 XP_005894360.1.15283 XP_010849071.1.44457 ENSBTAP00000020818 9913.ENSBTAP00000020818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]