SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005898155.2.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005898155.2.15283
Domain Number 1 Region: 2208-2302
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-31
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 505-643
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-29
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1472-1520,1598-1712
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1713-1867
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-24
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 961-1118
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-23
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 6 Region: 384-497
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-19
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 7 Region: 2299-2459
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000249
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 8 Region: 1127-1250
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000863
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000574
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005898155.2.15283
Sequence length 2568
Comment PREDICTED: LOW QUALITY PROTEIN: stabilin-1 [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MAGPRGHLLLCFLALCLAGPSFFGEQKVRSKRCDVKTKFVTHIPCTPCPAIKKRVCPLGW
IRAFPEKISQDCRYEVQLGDSLLSMSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETP
CSGHGTCLDGLDGNGTCVCQENFSGSACQECRDPNRFGPDCQSVCRCVHGVCRHGPRGDG
SCLCFAGYTGAHCDQELLACQALNCPRNSQCSEEAPSCSCLPGYTQQGHECRASDPCRPS
PCSPLAQCSVGPGGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSNSTLCLYRKPGQAS
CLCKPGLVSIAHDSSAGCFAHCSAFSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKASQTSMLLRLRVTFAMLDQGCREILSTSGPFTVLAPLVSSRTMNASVAQQLCRQ
HIIAGQHMLEEAGTQAPRRWWTLAGQEITVSFSRFRKYTYKYQDQPQQTFTIHKANYPAA
NGLFHVVTALRLQPPPELPEDPKRTIGQILASNEVFSRFETILENCGLPSFLDGPGPFTV
FAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYNHGQLTVEKLLSKGRVLTMANQIL
AVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPILPKLCNEEQHAVVA
GSCVDCQALNTSTCPPNSVKLDISPEECVYIHDPTGLNVLKKGCAYYCNQTIQKPGCCKG
FFGPDCLQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGDQCQED
CGCVHGLCDNRPGSGGVCQHGTCAPGFSGRFCNESTVSCGSTEQAQQCHPHARCVNQGGV
SRCLCLDGFEGDGFSCTPSDPCSRPDRGGCSENAECVPGARGAHHCMCHKGWSGDGRVCV
AVDECELDLRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLAT
CRAVGGGQRVCTCPPDYGGDGFSCYGDILKELEANAHFSVFYQWIKGAGIPLHADSQVTA
LVPSESAIRRLSTEDQAFWLQPRLLPQLVRAHFLQGALSEEELARLHGQNVSTLNPTVRW
EIHNVSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRRDVLGGQGLLQQLDSVPAFHL
FRELLQRHRLVPQIEAATAYTIFVPTNRSLEAQANSSSLDSDVVRQHVILGEALSTEALG
KGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLQAPGRSLFGLSGVLTVGSSRCLHS
HAEALREKCVNCSRKFRCTQGYQLEDTPRKSCVYRSGYSFSRGCSYTCAKKIQVPDCCPG
FFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGVC
DCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKISGPQCLQKCDPNANCVQDSAAAPVCVCA
AGYSGDGVSCSGPATPPPQSPFHAXCSPHANCTTVAPGQRTCTCLDGYTGDGELCREANS
CLIRHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRACVLLDPCSQNNGGCSPYAVCKST
GDGQRTCACDAVRTVGDGFTCRARISLELLRDKHASFFSLHLLEYKDLKGDGPFTVFVPH
ADLLTNMSQDELARIRANRQLVFRYHVVGCRQLRSQELLEEGYATALSGHPLRFSEREGN
IYINDFARVVSSDQEAVNGVLHFIDRVLLPPEVLHWEADAAPAPRRNFTAAAETFGYKIF
SGLVTMAGLLPLLQDSSHRPLTMLWPTDSALQALPPDRQVWLYHKDHRDKLAAILRGHVI
RNVEALASDLPNLGPLRTMHGTPISFSCSHARPGALTVGEDAARIVQRHLPFEGGLAYGI
DQLLEPPGLGARCDRFETRPLWLKVCSICGLEPPCPPGSQEQGSPEACWRYFSKFWTSPP
LHSLALRSVWTRPSHWGHPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCN
QRGSCMDGMSGSGECRCHTRFAGTACELCAPGAFGPLCQACNCTSHGRCDEGLGGSGSCF
CDEGWTGPRCEVQLELQPVCAPPCAPQAVCRAGNSCECSLGYEGDGRTCTVVNLCQDGRG
GCSEHANCSQAGTAVTCICWPDYEGDGWSCRARNPCEDGLRGGCSEHADCLNTGPNTRRC
VCHAGYVGDGLQCLLEPEPPVDRCLDRPPPCHADAVCTDLHFQEKRAGVFHLQAPSGPYG
LNFSEAEAACGAQGAVLASLLQLSAAQQLGLHLCLVGWLANGSAAHPVVFPAADCGDGQV
GVVSLGARENLSERWDAYCFRMRDVACRCRDGFVGDGTSVCNGKLLDVLATTANFSIFYG
MLLGYANATPRGLEFLDFLDDEXQLFVPVDEGFTDNTTLSGPDLELHASNTTFLSTNASQ
GALLPAHSGLSLIIGNLGPGNSSRAPEVPGAVVVSRVIVWDILAFNGIIHTLASPLLAPP
QARAVVAPEAPPVAVGVGAVVAAGAVLGLVAGALYFRGRSRSTGFGFSAFQAEDAAADDF
SPWQEGTSPTLVSVPNPVFGSHEAFCEPFDDSVLEEDFPDTQRILEVK
Download sequence
Identical sequences XP_005898155.2.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]