SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005907553.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005907553.1.15283
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000014
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 92-213
Classification Level Classification E-value
Superfamily SH2 domain 1.32e-25
Family SH2 domain 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005907553.1.15283
Sequence length 593
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 6 isoform X2 [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
SETFDSLTDLVEHFKRTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEETA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVVLQGRDSNIPGSD
YINANYVKNQLLGPDENAKTYIASQGCLEATVNDFWQMVWQENTCVIVMTTREVEKGRNK
CVPYWPEVGSQRVYGPYTVTNCGEHDTTEYKLRNLQVSPLENENLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVMQSQKGRESEYGNIT
YPPAMKNAHAKASRTSSKEDVYENVHSKNKKEEKVKKQRSADKEKNKGSLKRK
Download sequence
Identical sequences A5D980
ENSBTAP00000027046 ENSBTAP00000027046 NP_001091486.1.59421 NP_001091486.1.76553 XP_005907553.1.15283 9913.ENSBTAP00000027046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]