SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005909134.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005909134.1.15283
Domain Number 1 Region: 187-611
Classification Level Classification E-value
Superfamily Sema domain 1.44e-95
Family Sema domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1512-1635,1833-2018
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-39
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 971-1066
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000364
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 4 Region: 1063-1152
Classification Level Classification E-value
Superfamily E set domains 0.00000000000012
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 5 Region: 614-666
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1151-1195,1232-1285
Classification Level Classification E-value
Superfamily E set domains 0.000000102
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005909134.1.15283
Sequence length 2052
Comment PREDICTED: plexin-B3 [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MRRVGRDCIVGREAGTHSWHCQLLLGPSQEPHPATQPAQPGGCQPCHCHWALELAAVAHR
GQEGDPDWFPPHSHGLSTVGSVCRRGHDNAPYRHPVSVTTAPGQLNPGGVCHATQDMPLL
LLSARLAHPWELELLAMECPRVPSWLVPARTPNSGPEMAPRHLLGARLLLMLPLLCLPPT
PTGAHHFSAPNTTLHHLALAPGQGALYVGAVNRLFQLSPELQLESVAITGPVLDSPDCVP
FRDPAECPQAQLTDNTNQLLLVSGRARELVACGQVRQGVCEKRRLEDVAELLYRAEDPGD
GQFVAANTLGVPTVGLVVSGPDRDLLLVARGLAGKLSAGVPPLTVRQLAGPQPFSSEGLG
RLVVGDLSDYNNSYVAALADAQSAYFVFRRRGDRAQAEYRSYVARVCLRDANLYSYVEVP
LSCRGHGLVQAAALAPGALLGAFAAGLRGVQAALCAFPLAELDASMERARRLCYTAGGRG
PSGTEEATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRQPVEAGPLLQLKHSISAV
AALQADGHTIAFLGDVRGQLHKVFLNGTQGQVYHSQQVGTPGSAISPDLLVDSSGSHLYV
LTSQQVARVPVAACPQLPDCSSCLQAQDPLCGWCVLQGRCTRKSQCRRATQPNQWLWTYA
DGLCLHIESVLPAHHPRQEQGQVTLSVPRLPTLATDEYFHCAFGNYDSLAHVEGPQVACV
TPPQDQLPLNPPGTDHITLPLALMFEDVTVAATNFSFYDCSAVTALEAAAPCRACVGSLW
RSHWCPQSSHCVYGERCPEGERTIYSTQEADIQVRGPGACPRVEGLVGPLLVPVGWESRL
ALRVQNLQHFQGLPASYHCWLELPGQLQRLPASLEEVAGDSGLIHCQAQQFQPSMVQREL
PVPIYVTRGEGQRLDNAHSLHVTLYDCAVGHPDCSHCQAANGSLGCLWCSHGQPACRYGP
LCPPGAVETLCPTPRIETVEPLTGPPEGGLVLTIQGSNLGRDFADVQDAVSVAGRPCRPE
PSLYRISTRIVCVTSPAPNRTMGPIQVAIKGRPPGISTQYFTYQDPVLLSLSPQRGPQAG
GTQLTIHGQRLQTGGNISAFVGSQPCPIQEPVCPEAIVCHTMPQASPGDAVVRVVFGQAQ
RLLLTSPFHYTANPQLVAAEPSVSFRGGGRLIRVRGTGLDVVQQPLLSVWLETSEGTTVK
LQSQDLTPRSGCEVPAAAPQACTQLERGWLQCSSVCSINSSTLLLCRSPAVPDTASPRRV
FFSLDNMHVDFASASGGQDFLYQPNPRLAPLHHEGGPPRPYRLKPGHILDVEGEGLNLAI
SKEEVHVHIGDGECLVKTLTLTHLYCEPPPRVPQPSNGSGTLLQFVVQMGNVRLALGPVQ
YEVEPVLSAFPVEAQVGLGVGAALLITAVLLLTLMYRHKSKQALRDYQKVLVQLENLEIG
VGDQCRKEFTDLMTEMTDLSSDLEASGIPFVDYRTYTERVLFPGRSGGTLQPAVEGLGEE
GRRAPVHQGLMQLSNLLNSKLFLLTLIHTLEGQPSFSQRDRCHVASLLSLALHSKLEYLT
EIMRTLLSDLASHYVRKNPKLMLRRTETMAEKLLTNWVSICLYAFLREVAGEPIYMLLRA
IQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFRALTLMVLASPGPGGPSRSNTALHIPT
RVLDTDTITQVKEKVLDQIYKGTPFSQRPSAHTLDLEWRSGLAGHLTLSDEDVTSVTQNR
WKRLNTLQHYKVPDGATVRLIPQLHNGGGIISQSLAPSCPSGENTPMLEDSEEGGVHLWH
LVKAPEEPEAAKARRSSLRDRDRERARAKAIPEIYLTRLLSMKGTLQKFVDDAFQAILSV
NRPVPIAVKYLFDFLDELAEKHSIEDPETLHIWKTNSLLLRFWVNTLKNPQLIFDVRVSD
NVDAVLAVIAQTFMDSCTVSEHKVGRDSPVNKLLYAREIPRYKQMVERYYSDIRQSPPAS
YQEMNSALTELSGNYTSAPHCLQALQELYTHIHRYYDQIIGALEEDPVGQKMQLACRLQQ
MAALVENKVTEL
Download sequence
Identical sequences XP_005909134.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]