SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005910070.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005910070.1.15283
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 1.02e-17
Family S100 proteins 0.0000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005910070.1.15283
Sequence length 99
Comment PREDICTED: protein S100-A3 isoform X2 [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MASLLEQALATLVRTFQEYSQFSGNPLCQAKFKELLEKELPTWAPTTLRECDYKQFISVL
DTNKDCQVDFVEYMRLLACLCIYCHEYFKDSPLKPSCAQ
Download sequence
Identical sequences A4FUH7 L8HS94
ENSBTAP00000044222 9913.ENSBTAP00000044222 ENSBTAP00000044222 NP_001076999.1.59421 NP_001076999.1.76553 XP_005910070.1.15283 XP_010836720.1.44457 XP_010836721.1.44457 XP_010836722.1.44457 XP_019813906.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]