SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005922893.1.24487 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005922893.1.24487
Domain Number 1 Region: 141-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-70
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 73-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005922893.1.24487
Sequence length 410
Comment PREDICTED: COUP transcription factor 1 isoform X1 [Haplochromis burtoni]; AA=GCF_000239415.1; RF=representative genome; TAX=8153; STAX=8153; NAME=Haplochromis burtoni; AL=Scaffold; RT=Major
Sequence
MAMVVSVWRDPQEDVAGPPSGPNPAAQPAREQQQAASAAPHTPQTPSQPGPPSTPGTAGD
KGSQNSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRANRNCPID
QHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISL
LLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSL
LRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKT
LHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLL
LRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
Download sequence
Identical sequences I3K1B3
ENSONIP00000014908 ENSONIP00000014908 XP_003452669.1.78416 XP_004544446.1.88231 XP_005722415.1.53837 XP_005922893.1.24487 XP_006784158.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]