SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005923153.1.24487 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005923153.1.24487
Domain Number 1 Region: 254-351
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 415-705
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000942
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 176-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000321
Family I set domains 0.046
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000582
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 5 Region: 95-172
Classification Level Classification E-value
Superfamily EF-hand 0.000000000495
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005923153.1.24487
Sequence length 761
Comment PREDICTED: follistatin-related protein 4 isoform X3 [Haplochromis burtoni]; AA=GCF_000239415.1; RF=representative genome; TAX=8153; STAX=8153; NAME=Haplochromis burtoni; AL=Scaffold; RT=Major
Sequence
MAETGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLERRRIYVVHSKDCFFKGN
ACTMSEYNKLKSMLLDMQPKALKAGEQNQKRDMEEKRALVDTMFKYLDANQDGRLISDEL
EKISMKEHLEDSLLECTMQDLLRYDDYNNDGHLSLHEFYTAFQVVQLSLAEDQRISVSTV
TVGLSAVLTCAIQGTLRPPVIWKRNGIILNFLDLEDINDFGDDGSLYITKVTTIHMGNYS
CHAYGYEDLYQTHVLQVNVPPVILVYPETQAQEPGVSASLHCHADGIPNPKLLWLKNGMD
LQPRSSKQLSLIANGSELFIGSVRYEDTGAYTCIAKNEVGVDEDISSLFVEDSAKKTLAN
ILWREEGLSVGNMFYVFSDEGITLLQPSECEIRRHLKRTERIVATYEEMCPKGEGVSPQH
CVWSSAVNIRDKYIYVTQPLQSRVLVVDIQAQKVVQAVTTDPFPVKMLYDKSHDQVWVLT
WGDMDKTHPTLQVIPQASVGEVHHAIRTTFQRVNDFFIPPTNLIITHVRFAFVFLKNEPA
IHKIDLETLHRVKTISLKNNSCIPVSMAYTHLSGFYFIQCQTKSLLAPQQLLIDSVTDAV
IGPNLNVTGQAFVSPDGRYIVTPDPQSSKLIVQTVSFQGELSLNQEIDEPVAVSDLVFQP
SFTESNQHVAVATSGSGTDLLFADLSSGHTEVLRSLKQPLAPQAWPWGGPNRVVVSSGLF
GQYLVTPSAESLFVLNGKQRTPHCEVSDIKRGNTVVWVGEV
Download sequence
Identical sequences XP_005923153.1.24487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]