SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005989422.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005989422.1.90931
Domain Number 1 Region: 279-376
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 396-729
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 6.54e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 28-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000104
Family I set domains 0.037
Further Details:      
 
Domain Number 5 Region: 122-195
Classification Level Classification E-value
Superfamily EF-hand 0.0000000134
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005989422.1.90931
Sequence length 787
Comment PREDICTED: follistatin-related protein 4 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MENGQGGMTMSCERLFCGRGRECILNTESGRAECVCLQQCKFSYMPVCGSDGKFYENHCE
LHRASCLRKKKIYIIHSKDCFFRGDTCTMAEYSRLKSMLLDLQTQRSVHEDTTGQDRRSQ
KKVLVEALLENLDVNSDGHLDSTELAQAMKENDLLDDLLECSLQDLLRYDDYNNDGHLTL
HELYTAFQVVQLSLPEEQKVSITTVTVGLSAVLTCAIQGTLRPPIIWKRNSITLNFLDIE
DINDFGDDDSLYITKVTTVHMGNFTCHAHGYEELYQTHILQVNVPPVIRVYPETQAQEPG
VSASLKCHADGIPNPKITWLKNGIDITPKLPKQLTLLANSTELHISSVRYEDTGAYTCIA
KNEVGVDEDISSLFVEDSARKTLANILWREEGLSVGNMFYVFSDDGITIIQPTDCDIRRQ
IKPDERIVGSYEEMCPRGEGESTQYCIWASAVNVRDKYIYVTQPSQNRVLTIDIQTQKVM
QSIQTDPVPVRLHYDKSHDQVWVHSWGDMQKSLPTLQVITEASGGETHHTIRTLIERVDD
FFIPPTNLIINHVRFGFVFPKSEPAIHKIDLETMTRIETISLKNYSCIPQNMAYTHLGGY
FFVQCKVTSLASPLTQIIIDSVTDSVVGPNSDVSGTPYISPDGRYLISTDERGNMIRVQT
ITFQGKIKLKFDLQTNLHVADLAFQTSFSEGNQYSIYTTSQSQTDVLYVELSTGRMNILK
NLKDPISSQDWPWSSHNRIVMDSGLFGQYLITPSKESLFIINGRQNILHCEVSDIKRGNT
VVWVGDV
Download sequence
Identical sequences XP_005989422.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]