SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005990993.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005990993.1.90931
Domain Number 1 Region: 185-424
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-72
Family Nuclear receptor ligand-binding domain 0.00000000494
Further Details:      
 
Domain Number 2 Region: 65-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-28
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005990993.1.90931
Sequence length 426
Comment PREDICTED: oxysterols receptor LXR-beta isoform X2 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MGGLLQDPSNQEVMLSSVKEEPGRDPSPALQDGVSSPEGEESPAIDPEALPLKRKKGPAP
KMLGNEMCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKDARYSCKNDGKCQMDTYMRRKC
QECRLRKCRQAGMREQCVLSEEQIQRKKMRKQEEETVRASVITQHAPSVLPDPIGTGAMA
AATPLTTEQEKMIQQLVAAQQQCNKRSFSDQPKVTPWPAASDPHSREERQQRFAHFTELA
IISVQEIVDFAKQIPGFLDLSREDQIALLKASTIEIMLLETARRYNDENDCITFLKDFTY
SKEDFQRAGLQVEFINPIFEFSKGMRLLQLDDAEYALLIAINIFSADRPNVQDQELVERL
QLPYVEALHSYTLIKRPQDHLMFPRMLMKLVSLRTLSNAHSEQVFALRLQDKKLPPLLSE
IWDVHE
Download sequence
Identical sequences H3B5Q1
ENSLACP00000017222 ENSLACP00000017222 XP_005990993.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]