SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005992159.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005992159.1.90931
Domain Number 1 Region: 3-42,73-289
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.28e-71
Family PhyH-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005992159.1.90931
Sequence length 293
Comment PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X1 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MHPILEQQIQQYHRDGYLVLEGFFTLEECDLMRKRIKEVVEEMDVPMHCRTEFSTDEKEQ
LEAQGSADYFMTSGDQVRFFFEKGVFDSKGEFLVQKERSINKIGHALHALDPVFKNITHS
LKVQELVRKLGFQEPVIIQSMYIFKQPGIGGEVTPHQDATFLHTDPLGRVMGLWIALEDA
TEENSCLWFIPASHTGGVTRRMVRTLPGTHPRTEFIGSERSYKENEFVPVPVKKGGLVLI
HGEVVHRSSLNISERSRHVYSFHLMESKNTHWRKENWLQPTPELPFPSLYTSV
Download sequence
Identical sequences H3B857
XP_005992159.1.90931 ENSLACP00000018078 ENSLACP00000018078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]