SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005993787.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005993787.1.90931
Domain Number 1 Region: 385-747
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.81e-129
Family Hect, E3 ligase catalytic domain 0.00000000339
Further Details:      
 
Domain Number 2 Region: 12-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-23
Family PLC-like (P variant) 0.041
Further Details:      
 
Domain Number 3 Region: 291-331
Classification Level Classification E-value
Superfamily WW domain 0.000000000000428
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 153-192
Classification Level Classification E-value
Superfamily WW domain 0.0000000000148
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 245-286
Classification Level Classification E-value
Superfamily WW domain 0.00000000025
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005993787.1.90931
Sequence length 754
Comment PREDICTED: E3 ubiquitin-protein ligase SMURF2 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MSNQGVRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCLVDENTPIQGTNSATSGQTADPRIAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQQLPQHVSLS
QLPDEAECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMR
PKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSA
VNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHNSLV
WILENDTTGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVSEENKKEYVRLYVNWRFLRGI
EAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGQIDVNDWKANTRLKHCTPDSNIVK
WFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASPNNLPKAH
TCFNRIDIPPYENYEKLYEKLLTAIEETCGFAVE
Download sequence
Identical sequences H3B3I0
ENSLACP00000016451 XP_005993787.1.90931 ENSLACP00000016451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]