SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005996031.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005996031.1.90931
Domain Number 1 Region: 197-234
Classification Level Classification E-value
Superfamily WW domain 0.00000000001
Family WW domain 0.0017
Further Details:      
 
Domain Number 2 Region: 236-271
Classification Level Classification E-value
Superfamily WW domain 0.00000000633
Family WW domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005996031.1.90931
Sequence length 393
Comment PREDICTED: protein salvador homolog 1 isoform X1 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MLSRKKSKNEVSKPAEVQGKYVKKETSPLLKSLMPSFIRHGPTIPRRTDICLPDSGSVAY
PSAGDGMVSRNQSFLRTPVQRPPHEILRRESNRLSAPSYLPRSPTDILREYGVPSPSFLT
EVNTATENGDTSARYYYSDQYYEGPRRQQVPDRVHKDYRYYDHNNEHFQRLPQSQGRHTG
GIGRIPATSLGNLTNHSAEDLPLPPGWSVDWTIRGRKYYIDHNTNTTHWSHPLEREGLPP
GWERIESAEFGVYYVDHINKRAQYRHPCAPSVPRYDQPPPLPPPVTYQPRQAERNQPVLV
PANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELERIVKSY
EAYRQALITELEVRKQRQQWYAQQHSKNFPANV
Download sequence
Identical sequences H3AX13
XP_005996031.1.90931 ENSLACP00000014184 ENSLACP00000014184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]