SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006009610.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006009610.1.90931
Domain Number 1 Region: 132-166
Classification Level Classification E-value
Superfamily WW domain 0.0000000000771
Family WW domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006009610.1.90931
Sequence length 643
Comment PREDICTED: WW domain-containing adapter protein with coiled-coil isoform X1 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MVMYARKQPRLSDGCHDRRESQPYQTLKYPSKSHPSSGDHRHDKMRDATDPSPPNKMLRR
SNSPETKYGDGTGHSKQKTIHAHRVRERDGGTSYSPQENSHNHSVHSSNSHSSNPSSNPS
KTSDAPYEPADDWSEHISSSGKKYYYNCRTEVSQWEKPKEWMEREQRQKEASKLAVINSF
PKDRDYRREAMQATTTGGFSSGMEEKHASDAGSMLPQNILSQTSRHNDRDYRLPRAETHS
CAATVQHPIKPVVHPTAAPSTVPSSPFTLQSDHQPKKSFDANGAATLSKLHTPTSSIPVQ
KTERKESTSLEKSASHSCSTSSASSSSGLNPAATQSSSTSTVPVSPVPQSPIPPLLQDPN
LLRQLLPALQATLQLNNSNVDMSKINEVLTAAVTQASLQSILHKILTAGPSAFNITTLLS
QAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTPQTNTVPLKPMISTPPVSSQPKVS
NPVVKQGPAPQPVPPVAVDKQHGHDAASPRSLQRSSSQRSPSPGSNHTPSSSASSTAAVP
PNTSTRPPCSFTPTLAAHFNENLIKHVQGWPADHAEKQAARLREEAHNMGSIHMSEICTE
LKNLRSLVRVCEIQATLREQRILFLRQQIKELEKLKNQNSFMV
Download sequence
Identical sequences H3A1H8
ENSLACP00000003499 XP_006009610.1.90931 ENSLACP00000003499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]