SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006012443.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_006012443.1.90931
Domain Number - Region: 161-220
Classification Level Classification E-value
Superfamily TIMP-like 0.0863
Family Netrin-like domain (NTR/C345C module) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006012443.1.90931
Sequence length 285
Comment PREDICTED: meteorin-like protein [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MLPPIISYGIAIFLLCKIANSQYSSDQCNWKGSGLTHESHARDVEQVYLRCSEGTLEWLY
PTGALIVNLRPNTLSSSYKRLTVCIKPLRDSRGASIYLEKAGELKLLVSEENRRPNKVYC
YGMDQGALFIEATPKQDISKKITGFQYELRKQRVDTDLHTAPCRPCSDTEVLLAVCTSDF
AVRGSIRSVLHDAELQESTIDASVGRVYRQKSKIFRPIGKSGQWAGQIKAPLECGVKEGE
GDFLFMGSMHFGEARLGCTPWFKDFLRIYKEARDKGQNPCEISTN
Download sequence
Identical sequences H3A6X3
ENSLACP00000005394 XP_006012443.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]