SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006013591.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006013591.1.90931
Domain Number 1 Region: 44-82
Classification Level Classification E-value
Superfamily WW domain 0.00000000636
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006013591.1.90931
Sequence length 203
Comment PREDICTED: polyglutamine-binding protein 1 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MPLPLALQARLAKRGILKHVEPEPEEEIIAEDYDDDSVDYEATRAENLPPNWYKVFDQGC
GLPYYWNVETDNVSWLSPNDPAAIITKAVKKFKDPEDRPERMFEKVEREEVRDRRHQRRE
EIAPYSKGKKGREKRDEELDPMDPSAYSDAPRGSWSTGLPKRNEAKTGADTTAAGPLFQQ
RPYPSPGAVLRANAEATRAKQQE
Download sequence
Identical sequences H2ZX06
ENSLACP00000001927 XP_006013591.1.90931 XP_006013592.1.90931 XP_006013593.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]