SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006045377.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006045377.1.26621
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 7.23e-44
Family Globins 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006045377.1.26621
Sequence length 190
Comment PREDICTED: cytoglobin isoform X3 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPEKVSSVLSLVGKAHALKHKVE
PVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Download sequence
Identical sequences E1BMU2 V5V1J4
ENSBTAP00000007304 NP_001193649.1.59421 NP_001193649.1.76553 XP_005908066.1.15283 XP_006045377.1.26621 ENSBTAP00000007304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]