SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006053538.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006053538.1.26621
Domain Number 1 Region: 5-1209
Classification Level Classification E-value
Superfamily ARM repeat 9.69e-258
Family HEAT repeat 1.96e-20
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006053538.1.26621
Sequence length 1230
Comment PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK
NGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPA
SSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCL
LPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAA
ISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINI
CLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
VSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ
GETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGI
IFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEAL
LVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNL
GDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLR
KNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLA
KVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLT
GPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL
SLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEIT
SQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTL
IDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDL
NVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLD
IRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQ
RLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQS
QISSNPELAAIFESIQKDSSSTNLESMDTS
Download sequence
Identical sequences A0A0B8RT59 A0A0D9QWF7 A0A2K5D207 A0A2K5JR19 A0A2K5KZY4 A0A2K5QAS7 A0A2K6AD74 A0A2K6E382 A0A2K6MV74 A0A2K6NYI0 A7MBJ5 F6XT20 G3QF05 G7PHZ3 H2NHZ1 H9EMN0 K7DMQ8 K9J0D9 L5JW20 M3X6G0 Q86VP6
ENSSSCP00000000509 ENSTTRP00000005333 NP_001094643.1.59421 NP_001094643.1.76553 NP_001248621.1.72884 NP_060918.2.87134 NP_060918.2.92137 XP_002752780.1.60252 XP_002918370.1.58354 XP_003989066.2.62641 XP_004053571.1.27298 XP_004276653.1.21590 XP_004416755.1.74151 XP_004469092.1.11602 XP_004675975.1.23501 XP_005571532.1.63531 XP_005888197.1.15283 XP_006053538.1.26621 XP_006731249.1.47382 XP_006923775.1.64745 XP_007130289.1.24612 XP_007195118.1.59432 XP_007463638.1.90284 XP_008002130.1.81039 XP_008682480.1.72690 XP_010378223.1.97406 XP_010839872.1.44457 XP_011725539.1.29376 XP_011784654.1.43180 XP_011784655.1.43180 XP_011831968.1.47321 XP_011831969.1.47321 XP_011947223.1.92194 XP_012300354.1.9421 XP_014917935.1.86478 XP_015338529.1.40921 XP_016003968.1.101085 XP_017367764.1.71028 XP_017727057.1.44346 XP_019310578.1.44245 XP_019773910.1.83887 XP_019816417.1.53367 XP_020756144.1.74333 XP_021534354.1.83697 1u6g_C ENSBTAP00000013112 ENSGGOP00000000863 ENSMMUP00000010884 gi|21361794|ref|NP_060918.2| ENSBTAP00000013112 ENSDNOP00000002545 ENSPPYP00000005402 1u6gC ENSMMUP00000010884 ENSP00000442318 ENSSSCP00000000509 ENSTTRP00000005333 9544.ENSMMUP00000010884 9600.ENSPPYP00000005402 9606.ENSP00000299218 9823.ENSSSCP00000000509 9913.ENSBTAP00000013112 ENSCJAP00000013314 ENSCJAP00000051823 ENSP00000299218 ENSP00000442318 ENSPPYP00000005402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]