SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006053875.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006053875.1.26621
Domain Number 1 Region: 434-649
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000756
Family Armadillo repeat 0.072
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000453
Family APC10-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006053875.1.26621
Sequence length 925
Comment PREDICTED: centrosomal protein of 104 kDa isoform X1 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCQIRKLQ
LLAHQYMIPSKVEFYISESLPEYFTPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHQNHVNKYNVYNQVALVAVNIIGDPADFGDESNITSREKLIDHYLGHNAED
PALEGTCSGKSDYISPLDDLAFDMYQDPEVAQIIRRLDERKREAVQKERYDYAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMERFRSRVYEQLQLHELVDAELMRR
PLDLPLQPLACPSSPHHQPPMRSLPQPEERVTENRLTDPFLQEKPSSHCLDVSPQRPTVD
RPPPATDPPPKTHPDSLPYDERPLPVTRKQLGAAVSEAERRDVLSDEARRADAAGEPEPL
TEKALREASSAVDVLGEALVAGAYSKTWSHREDALLTLHKQLTDTPVGTPKEDLKSTLRA
AVFLVRRAIRDIVTPVFQASLKLLKMIITQYIPKHKLGRLETAHCVERTIPVLLTRTGDS
SARLRLMASNFIQEIALFKEVKSLQVIPSYLVQPLKASSSTHLAMSQMALLARLLRDLGT
EGAGFTVDSVMRFSVQALEHRVREVREAAVGMILDLYAQHRALVLEYLPPDDNTTRRNVL
YKTIFEGFAKIDGRPTDAEMRAQKRAAAEEAEKRKKEEIRALQGQLAALKEMQAEVQEKK
SEAMKAKNQDTQERKVAPPNAPEIPDNHYLDNLCIFCGERSESFTEEGLDLHYWKHCLML
TRCEHCRQVVEISSLTEHLLTECDQKDGFGRCYRCSEAVSKEELPRHVKTRDCNPAKSEK
LASRCPLCHENFSPGEEAWKAHLMGPAGCTMNLRRTHVLHRTPVLPPGKGPAATRAGTSG
SKVGSKIPTPKRGLSKGSSRTYTKR
Download sequence
Identical sequences XP_006053875.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]