SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006066395.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006066395.1.26621
Domain Number 1 Region: 65-507
Classification Level Classification E-value
Superfamily Sema domain 1.02e-112
Family Sema domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1359-1488,1665-1851
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-48
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 846-940
Classification Level Classification E-value
Superfamily E set domains 1.1e-16
Family Other IPT/TIG domains 0.0055
Further Details:      
 
Domain Number 4 Region: 938-1028
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000191
Family Other IPT/TIG domains 0.052
Further Details:      
 
Domain Number 5 Region: 512-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000138
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 1026-1138
Classification Level Classification E-value
Superfamily E set domains 0.0000624
Family E-set domains of sugar-utilizing enzymes 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006066395.1.26621
Sequence length 1884
Comment PREDICTED: plexin-B2 isoform X2 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MRGSQTLPVNTALPKASAPRETSPLAAEQTAFSLPEEGSGTMALQLWALALLGLAGTSAT
LRPRKLDSFRSETELNHLVVDEASGMVYVGAVNMLYQLSADLQLEQRAATGPALDNKKCT
PPIEVSQCHEAVLTDNVNQLLLLDPPRSRLVECGSLFKGICALRALGNISTRLFYEDGSG
EKSFVASNDESVATVGLVGAADPGGERLLFVGKGNGPHDNGVIVSTRLLDRTEGREAFEA
YTDHATYKAGYMSSNTQQFVAAFEDGLYVFFVFNQQDKHPARNRTLLARMCKQDPFYYSY
LEVDLSCLDPGDAQAPAFGTCLAASLDRPGSGGVLYAVFSTDGRGGRGPRTGLCLFPLDE
VHRRMEANRDACYTGAREVARDTFYKPFHGDIQCGGHVSGASKSFPCGSEHLPYPLGSHD
GLSAKAVLHRGGLNLTAVTVTSENGHTIAFLGTSDGRVLKVYFAPDGSSTEYGAVLVEIN
KRIKRDLVLAADLASLYAMTQDKVFRLLVQECASFSSCTHCQSSQDPYCGWCVVEGRCTR
KAECPRAAESGHWLWSRNESCVAVTGAHPQNMSRQAQGEVQLTVSPLPALSDDDMLLCLF
GGSPPHPARLQEGAVVCNSPSRSSLPRTPPGQDHVAVTIRLHFKRGNVFLTSHQYPFYDC
REAMSLQENLPCISCSSNRWTCQWALLEHACQQASPGPEDGVVGAHMEDDCPQFLNPSPL
VIPVNHETDVTFQGKNLDTVQGSPLLVGSDLLKFEASVSTQEPGTFSFRTPKLTHDANET
LPLHLYVKSAGKNVDSRLQVTLYNCSFGRSDCSLCLAADPAYRCVWCSGQSRCVYEALCS
NATSECPPPVVTRIQPETGPLGGGIRVTILGSNLGVRADDVKRVTVAGQNCAFEPERYSV
STRIVCTIEAAEAPCTGGVEVDINGKLGHSPPHAQFTYQQPQPHSVEPKQGPQAGGTTLT
INGTHLDTGSEEDVRVTLNDVPCNVTQFGAQLQCVTGPQAVPGELALKIYYGGSEVPSPG
ITFTYRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQRFAMVVIAEPLQSWRRRRETGP
LHSVTVVGTEYVFYNDSKVVFLSPAVPEEPEAYNLTALIRMDGHQALLRTEAGAFEYVAD
PTFENFTGGVKKQVNKLIHARGTNLNKAMTIHEAEAFVGAERCIMKTLTETDLYCEPPEV
QPPPKRRQKRDTAHNLPEFIVKFGSREWVLGRVEYDTRASDVPLSLILPLVIGPMVAVIA
VSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEAGIPV
LDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRRQVVEQALYQFSNLLNSKCFLINFIH
TLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSE
TVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLL
GDDVEYTPLTVSVIVQDEGVDAVPVKVLNCDTISQVKEKIIDQVYRTQPCSRWPKADSVV
LEWRPGSTAQILSDLDLTSQREGRWRRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDL
PGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQ
FVDNFFQSVLAPGNAVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILK
NPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVED
YYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPA
AQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences XP_006066394.1.26621 XP_006066395.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]