SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006068734.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006068734.1.26621
Domain Number 1 Region: 77-257
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-54
Family F-box associated region, FBA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006068734.1.26621
Sequence length 260
Comment PREDICTED: F-box only protein 50 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MEEVREGPELGGGMEEPASPQEPASPPPPPSPPSPAAPETPRLPAPESPTEAHARQLLLQ
EWAPPRGSLELPPRLTWKLLFLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQQPLEALGN
FRGWHIRTEKLQQNLSWTVKQQCVDLLAEGLWEELLDDEQPRITVMDWFEDSRLDACVYE
LHVWLLAADRSTVIAQHHVAPRTSGRGPPGHWIQVSHVFRQYGPGVRFVHFLHKTKNRME
RGGLRRTRVTDSSVSVQFRE
Download sequence
Identical sequences G3N3T9
ENSBTAP00000056600 ENSBTAP00000031988 XP_002695095.1.76553 XP_006068734.1.26621 XP_597250.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]