SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006074098.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006074098.1.26621
Domain Number 1 Region: 527-746
Classification Level Classification E-value
Superfamily Bet v1-like 8.24e-40
Family STAR domain 0.005
Further Details:      
 
Domain Number 2 Region: 93-246
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006074098.1.26621
Sequence length 755
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X1 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MQHSGVPIPPSPFSAPPTFLPGVTREGRRGPNSGGGAGRSAGVTATATADGWKGRLPSPL
DLLPRSAWCQARRRRRRRRGGRTPSLLPLPPAPERALLPSPSLDPSPRGLGASTGAAQGA
GAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKN
NTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWI
DAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRD
ILCRQVDTLQKFFDACADAVSKDEFQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKVFP
HVAPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRMDKETEKRRRVEE
AYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHW
STSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSL
QDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRN
DWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKISALNENDPETWIVC
NFSVDHSSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWA
PASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_006074098.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]