SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006079041.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006079041.1.26621
Domain Number 1 Region: 35-526
Classification Level Classification E-value
Superfamily Sema domain 2.62e-98
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1377-1502,1668-1824
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 854-946
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000934
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 945-1035
Classification Level Classification E-value
Superfamily E set domains 0.000000000000168
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 1033-1113
Classification Level Classification E-value
Superfamily E set domains 0.0000000000682
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 527-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000235
Family Plexin repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006079041.1.26621
Sequence length 1892
Comment PREDICTED: plexin-D1, partial [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
PPRPPFRAPQCPPPPLLLWLLLLLGAARIGALEIQRRFPSPTPTNNFALDGAAGTVYLAA
VNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQG
LVVVCGSIYQGFCQLRRRGNISAVAVPFPPAAPPAAPVTVFPSMLNVAANHPNASTVGLL
LPPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTF
DLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPRPGAQTYAYLALNSEARAGDKESQAR
SLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPTRELLFAVFERP
QGTPAARAAPAALCAFRFADVQAAIRAARTACFVDPAPDVVAVLDSVVQGTGPACERKRN
IQLQPEQLDCGAAHLQHPLSVLQPLKALPVFRAPGLSSVAVASVGNYTVVFLGTVSGRLL
KINLNESMQVVSRKVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQVGAADAYCGWCALET
RCTLQQDCANASQPHFWTSASAGPGRCPTMTVLPAEIDVHQEYPGMILQISGSLPSLSGM
EMACDYGHGIHTVARVPGPAFGHQIAYCNLLPKDQFPPFPPHQDHVTVEMSVRVQGQNIV
RASFTIYDCGRVGQVYPHTACTSCLSAQWPCFWCAQQHACVSNQSRCEASPNPTSPQECP
QILPSPLAPMPTGGSQSIPVHLASAAFFQGAALECSFGLEETFEAVWVNESAVRCKQVVL
HTTQKSQVFPLSLQLKGRPARFLDSPDPMTVEVYNCAVGSPDCSQCLGREDLGHLCVWSD
GCRPRGTLQPTPGTCPAPEIRAIEPLSGPLDGGTQLTIRGRNLGRRFSDVAHGVWIGSVA
CEPLADRYTVSEEIVCATGPAPEAFSDVVMVNASKEGRSRERFSYVLPLVHSLEPAMGPK
AGGTRITIHGSELHVGSELQVLVNNTEPCTELLRSDASIACTVPGGTLPAMVPVCVRFEQ
RGCVRGGLSFQYMPNPVITAISPHRSHVSGGRTITVAGERFHMVQKVSMAVHHIGREPTL
CKVLNSTLITCPSPGALSNASAPVDFFLNGRVYADEAAVAEELLEPEEAQRGSQFRLDYL
PDPQFSTAKREKWIKHHPGEPLTLVIHKEQDGLGLESHEYRVKIGQVACDIQIVSERVIH
CSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVF
CTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKH
FVTRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLF
SSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDA
SAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAI
TGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCK
NVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMS
LTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKAHRQSHRKKVLPEIYLTRLLSTKGT
LQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWV
NILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRK
IVQRYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMSALE
ANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_006079041.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]