SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006081825.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006081825.1.53796
Domain Number 1 Region: 734-980
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.21e-62
Family Nuclear receptor ligand-binding domain 0.0000000664
Further Details:      
 
Domain Number 2 Region: 598-676
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-27
Family Nuclear receptor 0.0000222
Further Details:      
 
Weak hits

Sequence:  XP_006081825.1.53796
Domain Number - Region: 692-699
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006081825.1.53796
Sequence length 982
Comment PREDICTED: mineralocorticoid receptor isoform X2 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
METKGYHSLPEGLDMERRWGQVSQAVDHSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPCLQQDNNRSGILTSDIKTELESKELSVTVAESMGLYMDSIRDAEYTYD
PQNQQGSLSPAKIYQNVEQLVKFYKENGHCPSTAGMSRPLRSFMADSGSSVNGGVMRAIV
KSPLLCHEKSSSVCSPLNMTSSACSPAGLSSVSSTSASFGNFTVHSPITQGTPLTCSPNI
ETRGSRSHSPAHASNVGSPLSSPLSSMKSPVSSPPSHCSVKSPVSSPNVTLRSAVSSPAN
INNSRCSVSSPSNTNNRSTLSSPTASTVGSICSPVSNAFSYTASGTPLGSSAARDLVSSP
DTQEKGAHEVSFPKIEEAENATSNGVTGQLNIVQYIKPEPDGVFSSSCLRGNSKMNPASP
FSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDSSYFSFMDDKDYYSLSGILGPPVPGFDG
SCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRAARDQ
SFQHLSSFPPVNTLVESWKSHSDLASRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKI
CLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQK
CLQAGMNLGARKSKKLGKLKGIHEEQSQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTA
LVPQLSTISRALTPSPGMILETIEPEIVYAGYDGSKPDTAEGLLSTLNRLAGKQMIQVVK
WAKVIPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQ
SAMYELCQGMHQVSLQFVRLQLTFEEYTIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKE
LRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVE
IISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G1PAS1
XP_006081825.1.53796 ENSMLUP00000007404 ENSMLUP00000007404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]