SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006082059.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006082059.1.53796
Domain Number 1 Region: 288-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-55
Family SPRY domain 0.0000623
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-20
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000458
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  XP_006082059.1.53796
Domain Number - Region: 134-195
Classification Level Classification E-value
Superfamily t-snare proteins 0.0942
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006082059.1.53796
Sequence length 468
Comment PREDICTED: putative tripartite motif-containing protein 75 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MAGEEAVAKLQTEINCPICLGILGDPVTIECGHNFCRFCIQHTWADLQDRFPCPVCRHPC
KERHLWSNTQLGRMVDMAKHLQITVAKMKQQEQKRLCEKHNQALTLFCEDDLKLLCPLCT
QPPDHQGHHVRPVEEAASHHRQKLRSYIEPLKKQLADLQKLLATQDRQQSELREKVEKQR
VKLASEYESVLASIECEQAAVHSRLAAQEKHILQNLIANKAAFSDHISKLRALRKEMAET
SVVSDVKLLMNIKGVLPRCENLEPPGVYCFQFSREEFSLPPQCSALQKIIQRFREEVTLD
PETAHANLLVSEDKKSVTFVRKKQGVHRNPKGVADDPVVLGSEGFDCGRHYWEVQVDDKP
EWAVGVCKDSLSKERKQPLLRQENRCWTIQLQDGDYVAHGPVPVTLVLQEMPRGIGIYLD
YEMGHVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD
Download sequence
Identical sequences G1Q0B6
XP_006082059.1.53796 ENSMLUP00000017148 ENSMLUP00000017148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]