SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006085523.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006085523.1.53796
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily HMG-box 3.27e-32
Family HMG-box 0.00000625
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 9.43e-27
Family HMG-box 0.00000511
Further Details:      
 
Weak hits

Sequence:  XP_006085523.1.53796
Domain Number - Region: 167-212
Classification Level Classification E-value
Superfamily ARM repeat 0.000633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006085523.1.53796
Sequence length 215
Comment PREDICTED: high mobility group protein B1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDDEEEEEEEDEEEDDEEEDDDDE
Download sequence
Identical sequences G1Q2I5
XP_006085523.1.53796 XP_008157678.1.99482 ENSMLUP00000017918 ENSMLUP00000017918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]