SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006085712.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006085712.1.53796
Domain Number 1 Region: 160-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.73e-59
Family Nuclear receptor ligand-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006085712.1.53796
Sequence length 399
Comment PREDICTED: nuclear receptor subfamily 0 group B member 1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MAGEHHQWPGSILYNMLMSAKQKHEAEASEAREAPRARARGICWGCSCGAAPPLGGEGAP
GRRAVADLYRCCFCGEDHPRQGSILYHMLTNAKQVQEAPAVLRGACWGCACGAVPAVGRE
GLALLYRCCFCGQQHPRASIFYNLPASSKQMHAAQPVALPGAPWWNPWSGAQRRVSLQNP
QVVCEAASAALLRTMRFVKYLPCFQVLPLDQQLVLARSGWAPLLMLELAQDRINFEITET
LEPGWLQSVLTTRRRETEGDEPQPLPTPQERSIPPTEARLLPSAAEVQAIKGFLTKCWSL
GITAKEYAYLKGIVLFTPDLPGLRCVKYIQGLQWGTQQILGEHTRMMYRGYHVRVAELNS
VLFQLRFISANAVTELFFRSIIGAVSMDDMMLEMLCTTL
Download sequence
Identical sequences G1NZP4
XP_006085712.1.53796 ENSMLUP00000002944 ENSMLUP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]