SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006086473.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006086473.1.53796
Domain Number 1 Region: 529-775
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-62
Family Nuclear receptor ligand-binding domain 0.000000000504
Further Details:      
 
Domain Number 2 Region: 417-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006086473.1.53796
Sequence length 776
Comment PREDICTED: glucocorticoid receptor isoform X2 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MDSKESLGSPSREEIPSSELVGERGKVMDFYKTLRGGATVKVSASPPSLAAAPLSDSKQL
RLLVDFPKGSGSNAQQPDLSQAVSLSMGLYMGETETKVMGNDLGFPQPGQISLSSGETDF
RLLEESIANLSKSTSVPENPKSSASATVSVAPEEEFSKTHTDASSEQQNLKSQTGTNGGN
VKLYTADQRAFDILQDLEFPSGSPGKEMNESPWRPDLLIDEHCLLSPLGGEEDPFLLEGN
SNEDCKPLVLPDTKPKIKDNGDLILPSPSSVTLPQVKTEKEDFIELCTPGVIKQERLGPV
YCQESFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPISVG
SENWNRCPGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPASSSAASGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLLEVIEP
EVLFAGYDCSAPESAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWM
FLMAFALGWRSYRQSNANMLCFAPDLVINEQRMSLPFMYDQCKHMLYVSSELQRLQVSYE
EYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHEVVENLLHYCFQTFLDKSMSIEFPEMLAEIITNQLPKYSSGNIKKLLFHQK
Download sequence
Identical sequences G1PHX2
ENSMLUP00000010283 ENSMLUP00000010283 XP_006086473.1.53796 XP_006086474.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]