SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006088259.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006088259.1.53796
Domain Number 1 Region: 66-314
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.38e-57
Family Glycerophosphoryl diester phosphodiesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006088259.1.53796
Sequence length 331
Comment PREDICTED: glycerophosphodiester phosphodiesterase 1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MWLWETQGGLLGPFSFLLLLFLLVTRSPCNACLFTGILYLLLRLFSFEPLPARRALQVLQ
PRDRVSAIAHRGGCHDAPENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNTVDRTT
DGTGRICDLTFEQIRKLNPAANHRLRNDFPNEKIPTLREGVVESLNQNLTIFFDVKGHAN
KAIDALKKIYMEFPQLYNTSMVCSFLPEVIYKMRQTDRNVVTALTHRPWSLSHTGDGKPR
YDNMWKLSTFVVLDILLDWSMHNVLWYLCGISAFLVQKDSISPNYLKKWSAKGIQVVGWT
VNTFDEKSYYESYLGSSYITDSMLEDCPPHY
Download sequence
Identical sequences G1NYY0
ENSMLUP00000002642 ENSMLUP00000002642 XP_006088259.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]