SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006090530.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_006090530.1.53796
Domain Number - Region: 36-72
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0373
Family TB module/8-cys domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006090530.1.53796
Sequence length 129
Comment PREDICTED: tumor necrosis factor receptor superfamily member 12A [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MALAPLRPLPRLLVLGLGLALLSAAAGEPVSGTTPCSRGSSWSEDLDKCMNCESCPALPH
SDFCRGCAGAPSASFGLLWPILGGALSLALVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPGAALIQ
Download sequence
Identical sequences G1NVI5
ENSMLUP00000001286 ENSMLUP00000001286 XP_006090530.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]