SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006090835.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006090835.1.53796
Domain Number 1 Region: 374-494
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-27
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 2 Region: 497-535
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000109
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006090835.1.53796
Sequence length 535
Comment PREDICTED: suppressor of cytokine signaling 6 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MKKISLKTFRKSFNLTKSKEEADFMVVQQPSLASDFGKEDSLFGSCYGKDMASCDINGED
DKGAKNRSKSESLMGTLKRRLSAKQKQKGKGSGPSGSSADEDTFSSSSAPLVFKDVRAQR
PIRSTSLRNHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
DSVCQEQNSSLKSSESQNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLEEGMYPLEGPRSY
CLDGSSPMEVSAVPPPGGGSSFPEDENQVDQELVVAPEIFVDQSVNGLLIGTTGVMLQSP
RASHDDAPPLSPLLPPLQTNPIQRNFSGITGADAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences G1P7Z5
ENSMLUP00000006264 ENSMLUP00000006264 XP_006090835.1.53796 XP_006090836.1.53796 XP_006090837.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]