SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006092197.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006092197.1.53796
Domain Number 1 Region: 349-405,434-638
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.09e-40
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 65-179
Classification Level Classification E-value
Superfamily ARID-like 1.96e-30
Family ARID domain 0.0007
Further Details:      
 
Domain Number 3 Region: 288-350
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-17
Family PHD domain 0.002
Further Details:      
 
Domain Number 4 Region: 1139-1222
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000266
Family PHD domain 0.0079
Further Details:      
 
Domain Number 5 Region: 1602-1664
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000797
Family PHD domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006092197.1.53796
Sequence length 1690
Comment PREDICTED: lysine-specific demethylase 5A isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MAGAGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLGTEVQTSPEPGTRMNILPKRTRRVKSQSESGDVNRNTELKKLR
IFGAGPKVVGLAMGAKDKEDEVSRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECNKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGS
GFPVKDGRRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSF
CWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMGVLM
SEEEVFELVPDDERQCSACKTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDL
FRKLRDAVKEAETCASVAQLLLSKKQKHRQSPDCGRTRTKLTVEELKAFVQQLFSLPCVI
SQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELARLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAK
VCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQKAREWTTKVEAIQSGSNYAYL
EQLESLSAKGRPIPVRLDALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GIYGSGKNRRKKVKELIEKEKEKDLDHEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEA
MHSLRAANLAKMTMVDRIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSTQKKG
SSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPTFQQSA
FNRVVSSVSSSPRQTVDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIP
IKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG
AKAQLEELMMIGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKIKGKD
SSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPKKKKLKLSAEKAKELNKLAKKLAKEEE
RKKKKEKAAAAKVELVKENTEKKRERKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCK
DKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPDSPGQAPAPSFIMSYK
LPIEDLKETS
Download sequence
Identical sequences G1P6E2
ENSMLUP00000005634 ENSMLUP00000005634 XP_006092197.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]