SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006092275.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006092275.1.53796
Domain Number 1 Region: 42-309
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.45e-63
Family Glycerophosphoryl diester phosphodiesterase 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006092275.1.53796
Sequence length 314
Comment PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 1 isoform X3 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MSSTAAYYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAF
QHAVTIGTDMLELDCHITKDEQVVVSHDENLKRSTGVNVNISDLKYCELPPYLGKLDVTF
QRECQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNSVLIKKVSELVKQYRREHITVWGN
ANYEIVGKCYKENSDIPILFSVQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKE
PHKMSKSQKFLIWLSDILLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTD
YPTKLKNFLHSFSA
Download sequence
Identical sequences G1NXH1
ENSMLUP00000002069 ENSMLUP00000002069 XP_006092275.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]