SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006093974.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006093974.1.53796
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-69
Family BAR domain 0.00041
Further Details:      
 
Domain Number 2 Region: 244-276,306-363
Classification Level Classification E-value
Superfamily SH3-domain 4.5e-18
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006093974.1.53796
Sequence length 364
Comment PREDICTED: endophilin-B1 isoform X4 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MNMMDFNVKKFAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRVNNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTAALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSSYHSNNNQTSVVPVPSASSNVIGSSAMTSSGLVMTSPSNLIDL
KEGSGSRKARVLYDYDAANSSELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITYL
ELLN
Download sequence
Identical sequences G1PJS6
XP_006093974.1.53796 ENSMLUP00000011016 ENSMLUP00000011016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]