SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006095874.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_006095874.1.53796
Domain Number - Region: 398-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0221
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006095874.1.53796
Sequence length 1134
Comment PREDICTED: nck-associated protein 1-like [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMESSLKYINK
KFPNIDVRNSTQHLGPVHREKTEIIRLLTNYYQSFVDVMEFRDHVYELLNTMDACQCHFD
ISLNFDFTRSYLDLIVTYTSVILLLSRIEDRRLLIGVYNCAHEMLHGHSDPSFPRLSQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFARRNQGAEQWRSAQLLSLISSPPAMINP
ATSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIRDEVLQ
VHKVTEDLFSSFKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLTDEPG
LLGPKALYTFMALSFIRDEVTWLVRHMENVTKTKTPEDYTDSSIAELLFLLEEIRALVRR
HIKVLQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSTLSSLNLKQVDNGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKMLVETSDLST
FCFHLRTFEKMFAMTLEEPTMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQLLPKHSATTISKAKNKKTMKQRQTPKKGEPEREK
PGAESHRKNRSIVTNMDKLHVNLTELALTMNHVHSFSVFEHTIFPSEYLSSHLEARLNRA
IVCLAGYNATTQEIARPSELLAGVKAYISFIQSLAQILGADVSRVIRNALLQQTQPLDSI
GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREEEQHFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDVLVQIRSNFSKADLMASLLPQLTG
ADNVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF
ELASAAGVGCDIDPALVTAIANLKADTSSLEEEYKVACLLLIFLAVSLPLLATDPSSFYS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKIKTR
NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAYHLNRVLTNAH
Download sequence
Identical sequences G1PLR4
ENSMLUP00000011809 XP_006095874.1.53796 ENSMLUP00000011809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]