SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006095984.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006095984.1.53796
Domain Number 1 Region: 133-183
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000033
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 265-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000465
Family GABARAP-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006095984.1.53796
Sequence length 350
Comment PREDICTED: polycomb group RING finger protein 6 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MEGVPVLTRANAAAAKAEGAAAMPPPPPISPPALTPAPAAGEEDPPPLPEEGAPGCSGSR
PPELEPERSLGRLRGRFEDEDEELEEDEELEEEEEEEEEEMSHFSLRLEGCRPESEDEEE
RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ
PLYNIRLDRQLQDIVYKLVIDLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRTKKA
LESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMDLDP
ACQVDIICGDHLLERYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
Download sequence
Identical sequences G1P3N7
ENSMLUP00000004542 XP_006095984.1.53796 ENSMLUP00000004542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]