SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006098412.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006098412.1.53796
Domain Number 1 Region: 268-392
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.72e-37
Family Translational machinery components 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006098412.1.53796
Sequence length 392
Comment PREDICTED: 28S ribosomal protein S9, mitochondrial isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MAASCVSCGAVVSQRLLLRPRVSLAPRQVLWKAAELQSVPGPQILRLKHVTVVTTKKNVK
ALRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRAR
PIMKHPEQIFPKQKATQWGEDGRPFHYLFYTGKQSYYSLMHDTYGKILDIEKHKNQLQAK
GLFSEKDKTTDLIGSRWLIKEELEEMLVEKLSDQDYAQFLRLMERLLQCGAAEEEFVQSF
RRSVTVQSKKQPIEPVQHDAQGMAFSTSEGRRKSAKAEAVVYEHGNGRIKINGIDYLLYF
PVLQDREQLMFPFHFLDRLGKHDVTCTVSGGGRSAQAGAIRLAMARALCSFVTEEEVEWM
RQAGLLTSDPRVRERKKPGQEGARRKFTWKKR
Download sequence
Identical sequences G1NW81
ENSMLUP00000001571 ENSMLUP00000001571 XP_006098412.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]