SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006098546.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006098546.1.53796
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-38
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-36
Family Link domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006098546.1.53796
Sequence length 277
Comment PREDICTED: tumor necrosis factor-inducible gene 6 protein [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MIILIYLFVLLWEDAHGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYTEAKAVCEY
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPHCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGIFTDPKRIFKSPGYPNEYDDNQICYWHIRLKYGQRIHLKFLDF
DLEDDPSCLADYVEIYDSYDDIHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPLSNSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences G1Q1Y6
ENSMLUP00000017719 ENSMLUP00000017719 XP_006098546.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]