SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006098899.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006098899.1.53796
Domain Number 1 Region: 100-256
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.48e-29
Family UbiE/COQ5-like 0.041
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000000439
Family AlkB-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006098899.1.53796
Sequence length 406
Comment PREDICTED: alkylated DNA repair protein alkB homolog 8-like, partial [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
IVMDFKHPDGVTVPVMLPRRSLLVMTGESRYLWTHGITPRKFDTVQASKGHKSGIITGDV
GDLTLSKRGIRTSFTFRKVRQTPCDCSYPLVCDSQMKEPPPSFPESDKEASQLEQKYVHQ
VYEEIAGHFSSTRHTPWPHIVEFLKALPSGSLVADVGCGNGKYLGINKELYMVGCDRSQN
LVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRMAALEELARLLRPGG
KALIYVWAMEQEYKKKKSKYLRENRTSQGRQEINSDPSAQEQFVEPVPDTGHQDSACSVP
SINDFQKGRCNSKEVANCKLPIHTNRTSFHSQDLLVPWHLKGNASKEKPTEPFGPAGTHD
PGPVFHRYYHVFCEGELEAACQTLNNVSILQSYYDQGNWCVILQKV
Download sequence
Identical sequences G1PVG8
ENSMLUP00000015332 ENSMLUP00000015332 XP_006098899.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]